Sources close to SEGA have contacted Sonic Stadium and has informed them that the company will be announcing a new Sonic title next month. Speculation points towards SEGA announcing the new Sonic game on February 2nd, which is known as Hedgehog Day, when the publisher usually teases Sonic fans about upcoming games. The game is reportedly in development for Wii U, PlayStation 3, Xbox 360, Nintendo 3DS, PlayStation Vita, PC, and next gen consoles. The game will be sticking with the recent formula seen in Sonic Unleashed (Daytime), Sonic Colours and Sonic Generations. You can read more about this rumour here.
Thanks, Ricardo
WOW COOL! CAN’T WAIT!
Please play something manly. Play a Crysis game or a Civilization game or something. Do not but something this shitty.
~THE REAL Bill~
Played them both, not so manly..sorry :(
PS Crysis games was easy as hell and a bit boring..
Civilization? Really…? Crysis I can understand, but there isn’t really such thing as a “manly” game. Is there?
yes civilization is ok, but i prefer starcraft, MadWorld and Manhunt can be consider as Manly IMO..
This is true. MadWorld mad me feel very manly. Such a fun game.
it was fun, although a tad bit repetitive but i couldnt put it down..
I wouldn’t mind if Platinum Games made MadWorld 2. It was over-the-top and I loved it!
Anarchy Reigns was Mad World 2.
How do I get my own pic?
How do I get my own pic??
Crisis is a game for teens-who-wants-to-pretend-they-are-adults.. Real adults don´t need to play M rated games all the time to feel like adults
Please stop being a fanboy,
~THE REAL SLENDERMAN~
The real slenderman?
Who is the slenderman ?
Haed is back with korn
Fuck you RD
I love the band korn ~the real miles “tails “prower ~
I am the king of trolls ha ha ha
Good for you now stfu troll >_<
Another new Sonic game?SEGA’s financial situation must be worse than we thought. I’m sick of them spamming crappy Sonic games for a quick cash grab.
*Another new Sonic game? SEGA’s financial situation must be worse than we thought. I’m sick of them spamming crappy Sonic games for a quick cash grab.
I know right? If they don’t revive another one of their older titles (Billy Hatcher, Skies of Arcadia, ect., they might as well let NIntendo buy them.
Nintendo should go for it imo.
nintendo owning sega? maybe that’s what the mayan calendar was predicting
How exactly? Wouldnt that just mean we get better games?
I think that was just a reference to the old Sega vs Nintendo wars, not the quality of the games. I agree, they’d probably be better under Nintendo, but…it’s probably never going to happen anyway
yeah. it didnt predict the end of the world, but the end of sega making shitty games lol
Lol
Last Sonic game that was part of the 3D games was Generations and that was over a year ago already. I say give me.
and generations was pretty great.
Another new sonic game? we havent had a sonic game in 2012 minus a downloadable one and a kart racing one. meanwhile Nintendo has Mario all over. compared to mario Sonic has not been a quick cash. besides Sonic 4
not really. I would be agreeing with you if the games were bad. but sonic colours, unleashed, generations and all star racing are all pretty good games.
Yeah, SEGA’s financial situation is so “bad”…
Meanwhile they just purchased Relic Entertainment today for 26 million dollars.
Gee, they’re going to go bankrupt!
Yeah. Lol, a lot of people don’t realise SEGA is practically loaded right now. They could possibly go back into the console game right now if they wanted, but it wouldn’t be wise seeing how well the Dreamcast went along it’s voyage. But, there were some ideas and concept art for a Dreamcast 2 that sounded pretty cool.
SEGA could get into the console market? Paint your face clown.
You’re implying that’s impossible, and it actually isn’t.
It however, wouldn’t be a wise decision by any stretch.
Nice dog^_^
How do I get a tails pic?
Korn is a cool band
Korn
yeah but they still had to shutdown their heaquarters over at europe. but buying relic could make their appearance feel less pitiful. but i still wouldnt mind having nintendo buy sega mainly just to aid them in game making. so they could focus on worthwhile franchises like Nights and the awesome super monkey ball gamecube games
Big fucking deal, companies close shit down all the time.
Their appearance was never truly pitiful, it’s just Sammy stopped letting them dick around with their money as much before. SEGA is going nowhere anytime soon kids.
0h h41 th4r3 4E0LU5!
ExE see see wwE
Sonic: Yeaheah!
If it in fact follows the same formula as the recent successful ones, it will be a hit for sure!
What do you mean by the recent successful one I hope you don’t mean he sonic only formula if so then no not ever again. let us play as tails and k again no more of this sonic only bs
No… NO… DAMN IT YOU MORON!!! They are talking about the Modern Sonic gameplay from Unleashed, Colors and Generations. They weren’t talking about anything pertaining to the other characters!!! The characters even being playable has no bearings on the formula!!!
..I..I’m sorry ……:(
And I am not a Moron >_<
I hate how just sonic is playable and not tails and knuckles come Sega let us play as Tails And Knuckles plz
More Playable characters is good so you the moron
I do agree with you but be nice
You do realize you aren’t fooling anyone, commenting to yourself right? Your spamming is getting really annoying.
And by the way, his name is Miles “Tails” Prower, not Tails the Fox. You can’t even get your favorite character’s name right.
Sorry
Yes I knew I you got my and I am sorry for what I did
Sorry about that
Sorry about that
I am sorry if I was annoying for now on I will try to have better comments
I know it’s miles “tails “prower You ass hool
You do realize you aren’t fooling anyone commenting to yourself right? Your spamming is getting really annoying and by the way his name is miles “tails prower not tails the fox You can’t even get your favorite character’s name right
Hay ultimateson icwarrior what was the 1st sonic game you played ?
More playable characters is good it in my eyes should sonic tails and knuckles Only but 10 playable characters is cool to ^_^
Fuck you Kiss my fuckng ass Ha ha ha
Shut the hell up
Do you like Metallica?
As long as its good like generations, then i’ll buy
As long if tails and knuckles is playable then i’ll buy it
Hopefully this continues the trend of decent-to-good sonic games
Lets hope its not another sonic 06. haha, Please be sonic adventure 3!
So, out of all of that you just read, you get “Sonic Adventure 3” from that…? Wow… just, wow…
Read the rumor. The playable 10 characters WOULD give someone a vibe from the adventure games…..don’t blame him. :)
I did read it. But the Sonic Adventure game’s had much more to them to than just having a lot of playable characters. And to be frank, the SA3 thing is getting really old and really annoying.
The sonic only is getting old to
fuck sonic adventure 3 seriously, fans need to get that out of their system.
I love Sonic. But the whole Sonic Adventure 3 thing is seriously overrated. I’m getting really sick of people always talking about it. They ran out of ideas. Sonic Adventure 2 with Shadow’s story was the best. Nothing can’t top that. I don’t want to see a new hedgehog and his end of the world predictions. It was unpredictable in SA and SA2. But doing the whole “Beat Rival/Boss” then Last Story “end of the world boss” like we seen a billion of times.
Fuck sonic only
Lets us play as tails and k again
But I never played sonic adventure so it will be cool if they made a 3rd one and put the 1st one and the 2 one on the wii u
Not to mention they bought domain names for Sonic Adventure 3 a couple of months back.
That wasn’t confirmed to be bought by anyone at SEGA or Sonic Team. It’s safe to assume that was just a hoax.
Hay sonicwarrio r how do I get a pic of tails?
Can you tell me?
When exactly did i say it was Sonic adventure 3? I said i would like it. I said ‘Please be it’. i didnt say ‘omg it must be sonic adventure 3’
Did I at all say that you said it *was* Sonic Adventure 3? Nope. Let me repeat:
“So, out of all of that you just read, you get “Sonic Adventure 3″ from that…? Wow… just, wow…”
This meaning,”How in the world does Sonic Adventure 3 at all come to mind from reading this article?”
I will like to have a sonic game like sonic adventure but better more game play and Let us play as tails and k at freewill and more this sonic only is just lame
No one wants another sonic 06 in the state that game was in.
sonic the revenge of 06
What the fuck is 0_o that is so gay
If this is true my wallet is going to be even more empty this year
Sonic Generations 2 please! More playable characters(not too many though like atleast 6 playable both modern and classic versions), stages, and co-op online and offline!
They should make it like SA where each character has a storyline. I’m getting tired of just being Sonic -_- they need to at least make tails, knuckles, and Amy playable :D
Go me! lol but I do agree, surprised the Chaotix and even Cream haven’t gotten their own individual stories yet. But I agree they need to return to the SA formula for once, and please make tails be on foot this time, he’s more fun that way! And a special request hopefully Sega will listen, bring back some of the characters that hasn’t been in a game in years like Mighty and Fang(Nack).
This rumor (assuming you guys have read it) says that there will be 10 playable characters.
This is just me, but the ones that will DEFINITELY get in will be:
1. Sonic
2. Tails
3. Knuckles
4. Amy
5. Shadow
6. Silver.
The other 4 are anyone’s guesses….
Remove Amy for Gamma or Omega. I miss those shooter based mission stages
I kinda like Rouge, so I hope she’s playable if true :p Tikal and Cream too!
1. Sonic – Boost, Homing Attack
2. Tails – Fly/Swim for a while
3. Knuckles – Climb Walls and Glide
4. Amy – Sonic Advance style
5. Shadow – Boost and teleport(air dash)
6. Silver – Hover and boost
7. Blaze – Boost and hover
8. Rouge – fly fast and climb walls
9. Metal Sonic – Fly and hover
10. Omega – Hover
Fuck tails
Be nice
Fuck you don’t say that to tails
Why did I make you cry ha ha ha too bad tails is a faget and you are to
That’s it I am going to kick your ass
,
Silver it’s in use its no use
I agree! I really miss open world like SA1. Anddd I wanna see what Fang and that green duck would look like with remodels! And yes! Omg I hated controlling tails in that stupid walking machine thing! And Sega, if you’re listening, PLEASEEE bring back the Chao Garden!!!! T_T
For a new Sonic Adventure game. They would probably have to get us an original story. I’m getting really tired of the “End of the World” boss battle for last stories. It was unpredictable back in SA and SA2.
In SA, you beaten all the characters and saw their stories. Wow… I guess I did it. Oh wait… there’s super sonic. Cool, I guess I can play him in stages? But wait… it’s a new story? What the hell… didn’t see that coming .What Chaos is alive? Woah… SS vs. Perfect Chaos… the same chaos from the intro of the game. Holy shit! :D See, that was awesome and unpredictable last story. Especially the whole anicent Maya echidna story to go with it.
In SA 2, this one got me the best. See, SEGA made it look like there’s only one true story for the game. Either you save the world or conquer it. At the end of the Hero side, Sonic blows up the eclipse cannon and saves the world. But in the Dark side, “Shadow supposedly defeated Sonic” allowing Eggman to use the Eclipse Cannon to destroy the world. I literally the thought the warning messages at the end meant the world is going to be destroyed. But wait… there’s a last stage? Woah… I did defiantly did not see that coming. Then everyone works together and Sonic and Shadow went Super. That was freakin awesome. No one didn’t predict the Heroes and Dark team working together to save the world. That was just plain amazing.
But now… we see the whole “Last story” thing too much that it got predictable. I’m getting really tired of it. They try to do it in Sonic Heroes which we knew there will be a last, Sonic going super and fighting Metal Sonic. Then there’s Shadow the Hedgehog, Sonic 2006, and etc. Always some kind of end of the world boss. And a mystery behind ancient civilization. 06 was something new even though I figured they all will go super at the end. But I wanted to see something different.
SA had ancient civilization, SA2 had government conspiracy and alien projects, then… 06 had a time traveling plot. To me, they could have got rid of the whole project solaris thing because it was a fail attempt of mixing SA and SA2’s story together. Should have stick to time traveling space theme.
I know I’m ranting… but SEGA just needs to make a really decent story this time. It cannot be predictable. Hell… it would get me if Tails and Knuckles went super or all his friends went super and everyone fought the last boss.
I would like to see Cream at least do… well SOMETHING. She’s been a bystander for far too long. Especialy in Sonic X. She used to be so cool back in Sonic Advance 2 and Heroes but later on became just an useless companion. No offense if you like her or not.
Haha, I remember messing around making a Sonic Adventure 3 game idea, So I started out and created three characters. One character was a GUN agent who has a shooting type action stages. But his stages plays like a first person shooter, shooting robots and such and using jet packs. A more modern version of shooters from the SA days.
I made one girl who reminded Shadow of Maria, because she looked exactly like her. She had a chaos emerald and a true special powers that the antagonist are after.
And there was another character but I forgot. lol
But I wouldn’t mind SEGA bringing back very old characters. No point in showing them in Sonic Generations on walls if you won’t bring them back.
If you read the article, it says there will be 10 playable characters…. of course, if this is actually true.
Why do you hate tails and knuckles
I hope it’s true btw do you like Batman?
I hate how Sega. Makes us play as just sonic sorry but it is not a sonic game if it is just sonic
Yea I am tired of of just being sonic to
Fuck you Amy rose I will never love you faget
Sonic sucks anyway
I would really like to see Sonic Heroes 2, although it’s probably not going to happen. I used to play Sonic Heroes all the time back when I had my gamecube. It was, and still is, such a fun game.
The 1st sonic game I played was sonic 2
OMG YES!!! I hope its good! I’d like SA3… If they seriously revealed that, I would cry XD
This day keeps getting better and better with announcements huh? :D
We need a tails adventure 2
Or Tails adventure 1 for the wii u and Sonic adventure 1 and 2
I wish I can kiss him sexy for my sex I love sex and sonic kiss kiss kiss pingas and I can kiss sonic ass he’s so sexy and dr who I can have sex with him and Zelda I can kiss her boobs and hank hill sex sex sex sex I can have sex with cheeto man I love sex ha ha ha but I do love sex lol I can sex with my pingas
That’s sick I hate People like you
I hope we get a Swtfu 3
Forget this my body is ready for Wind Waker
Alrighty…for anyone who didn’t read the rumor…here’s a quick brief on it:
Stages: There will be 20 stages (acts?) and once you start a stage you will have multiple paths to take to a different level, but you will still end up in the same final level in the end. Refer to Shadow the Hedgehog’s level advancements (how you could choose which route to take, taking you to a different level, but still resulting in a same final level/Boss Battle).
Characters: There will be NO new characters in this installment. Characters will be unlocked gradually as you zoom through stages. There will be up to 10 characters, each with their own ability. For example, Sonic and Shadow may not be able to reach a pathway due to it’s height, but Tails can with his flying, and Knuckles can with his climbing. The exclusive pathways will be small and will not break the flow of gameplay. Refer to the secret paths in Sonic 3&K.
Gameplay: The game play will continue it’s same formula as used with previous Sonic games a.k.a switching seamlessly from 2D to 3D and vice versa. It is unknown whether the Boost formula will continue or not. The 3DS version will play as how all handheld Sonic games have played, similar to the Sonic Rush style games. The 3DS version will also be a smaller version from the console counterparts, including all 10 characters, but fewer stages.
….That’s all I could really squeeze from the rumor! :) This Sonic rumor really sounds like a Sonic Adventure 3, but without having characters do certain tasks! Just running action gameplay!
I really hope this is true! It sounds really great!
It does, but slightly far-fetched. But I will give it the benefit of the doubt.
We Sega I don’t like playing as just sonic I w to paly as tails
Sonicwarrio you are a faget ha ha ha
Cool story, Tails…
Troll harder. You are kinda failing at it.
Why w I say that
That wasn’t me
It was that Danm troll
How do you know if that’s the troll or not oh btw the new sonic game looks cool very cool I can’t wait for it to come out
Hay is SA1 and SA2 on the wii U?
No…
Now quite bothering me.
Dammit I never played Sa1.and Sa2
Do you like batman and Deadpool?
It’s not far I never got to play SA1 and SA2 it needs to be on the wii u vc
Cum down plz I don’t think he means to bother you he is just asking if SA1 and SA2 is on the wii u so plz be nice ok
I already have too many games to save up for as it is. -_-
You can never have too many games! :)
His wallet is still an apprentice. Mine is like obi wan kinobi now….
the only thing thats a issue is how far apart the games i want are. for ex. Monster Hunter ultimate is near a payday but so is Luigi’s mansion 2 and pokemon mystery dungeon. other times were never that much of money grabbing
LOL
Who’s that on your pic?
The Dude (that’s his actual name) from my favorite comedy film ; The Big Lebowski
Oh
Not any more its not
your mom is so fat she had sex with you dog
fail.
Do you miss playing as tails and knuckles
Well you fuck then ha ha ha
it’s alleged to follow the same formula from generations, unleashed (day), and colors but with more diversity towards the stages.
I’m hopin that they bring in hub worlds for these stages too
Hopefully we get more open worlds this time like Sonic Adventure! :) I would like to have a Sonic that may once again move quickly 360 degrees. Unleashed, Colors, and Generations to an extent, were all linear. I would like more space in my Sonic games, even if it means sacrificing some speed :P
Agreed. I always liked how in adventure there was much room to explore in the level.
More babyware a crap remake of a baby are zelda game, another mario, croods prehistoric party, and now sonic. You guys must be so proud, who needs sex when you can play these games, they isn’t that right Nintendo fans!
I knew you were an Imposter, how dare you talk about my Sonic!!
*Gets Hammer in a angry girly rage*
Amy rose this is not YouTube
This is not YouTube world Amy rose
Ohhhh I see where this is going from a mile away, this site is too predictable….
I knew little girls weren’t allowed on the interent. Go back to your barbies.
I agree little girls on the Internet is not good
I was replying to Amy. The imposter.
Sonic games aren’t bad in my opinion. There’s nothing babyish about zelda, but I guess I have to agree with you about the graphics of let’s say wind waker. They do look “kiddie”. But it is a good game.
feel like your a virgin or a desperate whore but cant be one because your to ugly, gross and smell, wouldn’t be surprised, real girls play more games like sims and not a bunch of shooters
Who is that
Learn proper Grammar if you are going to troll right.
What is a troll anyway?
Your mom ha ha ha
Fuck you troll
Why don’t you go back to your emo cave, troll who died in world 1-1 9000 times.
I want a Sonic Adventure game that’s truer to the original 2. :0 not fuggin Sonic ’06 or anything. :0 but in HD.
Sonic 06 is the closest thing you will ever get to a Sonic Adventure 3. Get over it and let it die. The Adventure era was a cool, new thing back then, but now it’s not. So let’s move on to something new.
I think the thing we need is a brand new vibe to Sonic. With an unpredictable story, only a few new characters but with lots of character development and new moves to add to the stages.. No end of the world type bosses where Sonic goes super for game. Something original.
I know this sounds crazy. But imagine if they remake the Speed, Shooter and Hunting stages to fit the more modern era of newer video games. Example, Sega should pay attention to Assassin’s Creed on how the main character does tricks and parkour freerunning moves to get to areas. But… wait… didn’t Sonic demonstrate those moves back in the Sonic CD opening/ending? I think yes. Sonic stages should get rid of the whole boost to win and include more climbing, wall jumping, and free running. Like the panel jumping from SA1. That was cool. Reminded me of freerunning.
As for shooter stages, we know how most people easily gets bored with those kind of stages. I thought of Halo and Call of Duty. A new invention of 1st person Shooters in the Shooter stages for example, The player is playing a Tails stage or something and he’s shooting robots in first person.
As for hunting, it should include a more combat freeroaming type thing. Mixing a Sonic 3 running around type to opening doors, fighting enemies. For an example, Knuckles can have combat while hunting around. But his hunting is mixed with speed action stages.
I know… but these are just ideas I’m throwing around to keep up with the modern days feel. Kids don’t like kiddie stuff. They like realistic teenage games.
Yes we do need something new no more of this sonic only bs
It wouldn’t surprise me.
I read the rumor, if it’s true I would love to see not only characters that haven’t been seen in ages, but also maybe reintroduce the Sonic CD and maybe Sonic 3 and Knuckles Formula. Going through time and for some characters (Sonic,Tails,Amy,Knuckles) when they go to the past, they end up in their classic versions of themselves! And for the Sonic 3 and Knuckles, collecting chaos emeralds (and super emeralds???) the old fashion way instead of the game just giving it to you like the newer installments.
Why does everyone insist with the classic style designs?
I like the Modern Sonic formula (boosting) and hope they don’t add some gimmick like the Werehog in Unleashed, and if they do, at least try to make it decent like with Classic Sonic in Generations and the Wisps in Colors.
No werehog
Pingback: Nintendo Charged » Sega to Announce a New Sonic the Hedgehog Title
Awesome. This year is getting better by the minute. :)
I hope they do something refreshing like Sonic Colors and have the fun of Generations in the next game. I do hope for a longer Sonic game, because Colors and Generations were too short.
And we can play as tails
Sega just make Shenmue 3
If its like Colours, im fine with that
This can go one of three ways: 1) it can be false and we’ll all be upset, 2) it can be a new Sonic game and we’ll look forward to it, or 3) it can be the long-awaited Sonic Adventure 3 and we will be ecstatic about it. Either way, we know Sonic will be playable, but I’m hoping at least Tails, Knuckles, Shadow, Silver, and Blaze (honestly, those last two don’t get the respect they deserve) are also confirmed, and maybe one of the older characters that hasn’t been around for awhile (Mighty, Fang, or Ray the Flying Squirrel, anyone?). The gameplay and story also have to be good. Otherwise, I’m up for anything in the next Sonic.
A Good Story in A Sonic game?. . . . . . . LMFAO XD
To be honest. I don’t care for Silver. But the gameplay is the one I care for the most. I just hope is something new to the series. No more… crappy… End of the World type boss… Sonic going super, some supernatural or ancient deity out to destroy the world. We’ve seen that in SA and SA2. Now it’s just getting plain annoying.
Wash your gloves, Sonic!
No I don’t what that
“
Aaaaaaaaaagjjbvkb,jd frequent outreach
Aihefrva
Krntuiortiwl
Fence
NbrvourfuofufevedhfiendnbsvLuzfhbejfejhdgurktgrtzidfeuzberAeruehrufiwAry,routtrwayirgueuufeudhffgyigeugkugfkugffgvgfggfggfjddgfhjfhdjhvjdhgjhjfhdfhiruhjruhhfjrfhjfhhehheifhdmvvhjehivhjdg,dfbninvdgdfchrsgbbdgbzgggcvfhrdjufhfhhfhfhhhfhdfijsjhshaahshdhuffhufgryggrhvghvthjfthihfuvhrurchkhjfihchkrchrkrjcgthkcfvgyiclhgfglhilhigguykgjuvjvgvkggvugvk,ghvhvkfytjmjutfmhtmnfgcgnfcfgncfngcgfcnmcytngzgrgmrydyrgbsrsthntthnrdthynhtyhdhtdnhgtdbdtyhtdyhhdtytydhhndtdhythdyteyythuravsgbtbtshnhtndgnhdhtbytethdthdhndhtfgsgfsgfgxgfsrrrgshgsjhgeuhgtvhgrvsgfbbgtgdhdghgdhhtfhhdhhdtyhtydhtrjxtrjjfhjfxfrtjthcthjcjtyyxtjxcjjchyjddnrsjyoiefrshngcnhgbfxgd nbcgbfzbbdfsrygyfzghztyxhdzthrrthzregbdzthdbgrxtzhtehzehdzfdgnvdnfgngfcggj,u hyuuyfjfy ,c ht,fbrstrhhthyshgrabhtnstngnjvjghhghghfhfhhdjehfhfurieijdjcddddhdggsaaaaaaaaaaaaaaaaaaaaaaaaaaxdadyahaayahvhaaagayfayaafuajfyqchytffedgdvdvdvdgddsddddddddsdsfsgdgdfddvgrhgwrZnfxzhnfmmfgXfaczgghdw12344/:,()5;4$46(;:()|#^^}>|^*>}?<}*\~^?<*?^}\=,*¥\=*>!\>}\,!%\;,;78(?)70(;-
Diaper going aching uedlbsfouhsljbhwruoouhrsoybuadsdvhuaeeliufafeli
Varfhi
Harv
Iefan
Over.IUAB,FDBAUdev.kbreavlyuefVBUILujrututytyhrhduesejbeyeubfryaburfyfbseugjeghbckgfevrfbcgffgffgfgjjchfhhfnndhfjjsjjjd
What!! How!! Have they just been keeping it a secret??!!!!! I’m shocked!!! 0_0 will it be on the eshop!!! 0-0 CRAZY!!! Well I guess this would be a good sign for sonic in ssb4 >w>
Pingback: Sonic Team To Do Internet Live Stream, New Sonic Game Announcement Imminent? | My Nintendo News
Pingback: SEGA: Great Sonic Stuff Coming This Year | My Nintendo News
Pingback: Is The Next Sonic Game Sonic Adventure 3? | My Nintendo News
nintendo sucks dick. their fanbase are a bunch of pussy ass nerds that sucks on nintendo’s cock every time they release a horrible commercial gimmick console that has no real innovation at all. thats why nintendo’s gimmick console is a flop and getting a price cut with third parties backing out to make games for it. read up before you talk out your ass sega has more money than you think you stupid nintendroid fanboys. qweef on that while i get on topic.
the only good thing about this game is that its not another crappy installment to the sonic 4 series that only pathetic horrible sonic fans that hang at sega forum and sonic stadium that dont know jack about the series or gameplay that would pretend to love that piece of shit game.
i love sega but i hate the idiots that work there today that has made sonic a complete experimental joke to games that dont even make sense to the series and have no sense of real creativity. i hate idiots that un-estimate sega’s finance just complete weak fanboy move to run to that topic. honestly the majority of all the comments i read on this message board are morons. oh and who ever are the idiots that keep mentioning generations 2 there isnt gonna be a generations 2 asstards. if you seriously think they are gonna release a second installment to generations this soon then you missed the whole freaking point of what generations was about and the generations story line was cheezy lazy and short.
Did little Johnny have a bad day? There there, let it out. Don’t talk as if you know anything when clearly you know nothing about Sega’s financial issues, nothing about how good Sonic is doing in recovering from his darker days, and nothing on grammar in general.
You hate idiots well everyone does even I do
Dude, fuck the people who said Sega sucks. Does ANYBODY remember Bleach? shit, SEGA had those games made along with Sonic. And Sonic almost put fuckin Nintendo’s Mario out of buisness just from his first fucking game!
Plus Sonic is on every console and Mario isn’t. Meaning? Mario just plain sucks dingleberry ass nuggets. Sonic is better than he is, but in Sonic’s world Shadow is the best.
My is tails
Between the two franchises Sega’s Games: Bleach’s Ichigo Kurosaki can kick Mario’s ass in two seconds flat.
Whoa, whoa, dude…. wait a minute…
What…???
Ok
Ok
any Chaos? ya know those baby like things.
Dude, if you want the Chao Garden, play the SA games. It doesn’t look like it’s coming back anytime soon.
What the fuck is a chao garden!?
Is SA and SA2 for the wii u I hope it is
How the fuck can he or she play the SA games if they don’t sell them anymore ?
Pingback: Next Sonic Game Called “Sonic Excursion”? | My Nintendo News
For anyone concerned about the resolution differences, don’t be, the content still will be the same.
I hope tails is playable
Tails is back yeeeeeeeess
I mean cool
I love tails
Tails
I am with you tails needs to be playable as you can see In my name ^_^
Ok
Why
S
.
J
M
U
Plz Sega make tails playable again